🌐 Mailman 3 February 2017 - Python-list - python.org

doubt loading pages
by José Manuel Suárez Sierra Feb. 1, 2017

Feb. 1, 2017

hello everyone, Im trying to make a program that takes an archive from pdb (for instance this link http://www.rcsb.org/pdb/files/fasta.txt?structureIdList=5HXY after reading it I want it to save in a list only this part of the archive: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMPAETNEYLSRFVEYMTGERKSRYTIKEYRFLVDQFLSFMNKKPDEITPMDIERYKNFLAVKKRYSKTSQYLAIKAVKLFYKALDLRVPINLTPPKRPSHMPVYLSEDEAKRLIEAASSDTRMYAIVSVLAYTGVRVGELCNLKISDVDLQESIINVRSGKGDKDRIVIMAEECVKALGSYLDLRLSMDTDNDYLFVSNRRVRFDTSTIERMIRDLGKKAGIQKKVTPHVLRHTFATSVLRNGGDIRFIQQILGHASVATTQIYTHLNDSALREMYTQHRPRY I have written this: import urllib2 seq=raw_input("Introduce pdb code \n") seq = urllib2.urlopen("http://www.rcsb.org/pdb/files/fasta.txt?structureIdList="+seq) print seq.read() seq.close() My question is, how do I save this into a python list? Thank you!

2 3

Re: Python3.6 tkinter bug?
by Christian Gollwitzer Feb. 1, 2017

Feb. 1, 2017

Am 01.02.17 um 00:02 schrieb MRAB: > On 2017-01-31 22:34, Christian Gollwitzer wrote: >>> .!frame.!checkbutton >>> .!frame.!checkbutton2 >>> .!frame2.!checkbutton >>> .!frame2.!checkbutton2 >> >> > Perhaps someone who knows Tcl and tk can tell me, but I notice that in > the first example, the second part of the widget names are unique, > whereas in the second example, the second part of the widget names are > the reused (both "!checkbutton" and "!checkbutton2" occur twice). It is indeed the reason, but it has some strange legacy cause: the default name for the checkbutton-linked variable is the name of the button inside the parent. Therefore creating a checkbutton has the side effect of creating a variable with the button's name. In this case, the first buttons in the frames are linked to a variable called "!checkbutton" and the other two are linked to "!checkbutton2". (a variable name in Tcl can be anything apart from the empty string). This can also be demonstrated by this Tcl script: package require Tk pack [frame .f1] pack [frame .f2] pack [checkbutton .f1.c1 -text "A" ] pack [checkbutton .f1.c2 -text "B" ] pack [checkbutton .f2.c1 -text "C" ] pack [checkbutton .f2.c2 -text "D" ] which is equivalent to the Python code above. Note that this surprising behaviour was corrected for the (modern) ttk widgets, so if "checkbutton" is replaced by "ttk::checkbutton", they are not any longer linked. In Python, that would be from tkinter import ttk ... w = ttk.Checkbutton() (Personally, I'm not using the legacy widgets any longer) > Do the names need to be: > > .!frame.!checkbutton > .!frame.!checkbutton2 > .!frame2.!checkbutton3 > .!frame2.!checkbutton4 Good question. Maybe there should be unique variable names? I.e., if the script is changed into package require Tk pack [frame .f1] pack [frame .f2] pack [checkbutton .f1.c1 -text "A" -variable v1] pack [checkbutton .f1.c2 -text "B" -variable v2] pack [checkbutton .f2.c1 -text "C" -variable v3] pack [checkbutton .f2.c2 -text "D" -variable v4] then they are also not linked. Christian

2 1

The use of sys.exc_info for catching exceptions
by Tiago M. Vieira Feb. 1, 2017

Feb. 1, 2017

Hi, I've came to a problem where I want to keep backwards and forwards compatibility with an exception syntax. And I mean by backwards going further down to Python 2.5. I was pointed to this option from a stack overflow answer[1] that works forward and backwards, I rewrite the solution here: import sys try: pr.update() except (ConfigurationException,): e = sys.exc_info()[1] returnString = "%s %s" % (e.line, e.errormsg) I understand that there has been a discussion about deprecating sys.exc_info() on [1] and in section "Possible Future Compatible Changes" on [2]. Aside of deprecating this function, what could be other possible issues if I use the solution above? Performance overhead or any known case that could cause problems? [1] - http://stackoverflow.com/a/2513890¬ [2] - https://www.python.org/dev/peps/pep-3110/#open-issues [3] - https://www.python.org/dev/peps/pep-3134/ Thanks! -- Tiago

1 0

SQL CE Database (.sdf) file connection with python
by Jay Desai Feb. 1, 2017

Feb. 1, 2017

Hello, I came across a post from Nikhil Joshi at https://mail.python.org/pipermail/python-list/2014-November/681568.html. *.sdf database access - mail.python.org<https://mail.python.org/pipermail/python-list/2014-November/681568.html> mail.python.org On Saturday, April 21, 2012 6:55:55 AM UTC-4, Alex Willmer wrote: > On Apr 19, 9:18 pm, Page3D wrote: > > Hi, I am trying to connect and access ... I am facing the following problem. Can anyone please provide some guideline? Problem Statement: Extract data stored in the .sdf file to python. System config: Win 10 Pro 64-bit, python 3.5.2-64 bit, adodbapi library, SQL CE 3.5 I am fairly new to programming and I have picked up Python as my first language to learn. Currently, I have hit a wall in process of connecting a SQL CE 3.5 .sdf file. I have used the adodbapi library. I have searched the web extensively over the past week to find a solution to this problem and to make sure that my connection string is correct. I have tried multiple options/solutions provided on stack overflow and https://www.connectionstrings.com/microsoft-sqlserver-ce-oledb-3-5/. Code: import adodbapi cons_str = "Provoider=Microsoft.SQLSERVER.MOBILE.OLEDB.3.5;" \ "Data Source=D:\Work\Programming\Python\SQL_DataTransfer\LF.sdf;"\ "Persist Security Info=False;" \ "SSCE:Max Database Size=4091" connection = adodbapi.connect(cons_str) print(connection) Error Message: Traceback (most recent call last): File "D:\Work\Programs\Python35.virtualenvs\sql_output\lib\site-packages\adodbapi\adodbapi.py", line 93, in make_COM_connecter c = Dispatch('ADODB.Connection') #connect after CoIninialize v2.1.1 adamvan NameError: name 'Dispatch' is not defined During handling of the above exception, another exception occurred: Traceback (most recent call last): File "D:\Work\Programs\Python35.virtualenvs\sql_output\lib\site-packages\adodbapi\adodbapi.py", line 112, in connect co.connect(kwargs) File "D:\Work\Programs\Python35.virtualenvs\sql_output\lib\site-packages\adodbapi\adodbapi.py", line 269, in connect self.connector = connection_maker() File "D:\Work\Programs\Python35.virtualenvs\sql_output\lib\site-packages\adodbapi\adodbapi.py", line 95, in make_COM_connecter raise api.InterfaceError ("Windows COM Error: Dispatch('ADODB.Connection') failed.") adodbapi.apibase.InterfaceError: Windows COM Error: Dispatch('ADODB.Connection') failed. During handling of the above exception, another exception occurred: Traceback (most recent call last): File "D:/Work/Programming/Python/SQL_DataTransfer/SQL_CE_reportDB.py", line 8, in connection = adodbapi.connect(cons_str) File "D:\Work\Programs\Python35.virtualenvs\sql_output\lib\site-packages\adodbapi\adodbapi.py", line 116, in connect raise api.OperationalError(e, message) adodbapi.apibase.OperationalError: (InterfaceError("Windows COM Error: Dispatch('ADODB.Connection') failed.",), 'Error opening connection to "Provoider=Microsoft.SQLSERVER.MOBILE.OLEDB.3.5;Data Source=D:\Work\Programming\Python\SQL_DataTransfer\LF.sdf;Persist Security Info=False;SSCE:Max Database Size=4091"') At this point any help is much appreciated. Thank you, Sincerely, JD.

2 1

Qtcore error problem
by Xiao Zhang Feb. 1, 2017

Feb. 1, 2017

Dear python users, I am new to python and now I met a problem. When I try to run a py file, I got the following error: from vacumm.misc.grid.regridding import regrid2d File "/home/xzhang3/usr/local/uvcdat/2.4.1/lib/python2.7/site-packages/vacumm/misc/__init__.py", line 41, in <module> import color File "/home/xzhang3/usr/local/uvcdat/2.4.1/lib/python2.7/site-packages/vacumm/misc/color.py", line 50, in <module> import pylab as P ImportError: /home/xzhang3/usr/local/uvcdat/2.4.1/lib/python2.7/site-packages/PyQt4/QtCore.so: undefined symbol: _ZN7QLocale14scriptToStringENS_6ScriptE I searched the web and it looks like the problem has something to do with different versions. Any idea how to fix the problem ? I am using python 2.7 now. Really appreciate your ideas and best regards, Xiao

1 0