🌐 Mailman 3 August 2004 - Tutor - python.org

Output to a printer
by Bob Fleming Dec. 29, 2004

Dec. 29, 2004

I am learning Python on a Windows system (Win95). All of the tutorials, documentation, and a book that I am studying all assume printing to the console (stdout). I live in the real world and will need to print out to my laser printer or other device. How do I modify the print or write statements, or redirect stdout, to print to a printer? Thank you, Bob Fleming robertf(a)eskimo.com

5 5

Another prob with Telnet
by Ali Polatel Sept. 5, 2004

Sept. 5, 2004

Friends, I write a programme which connects to FICS via telnet but this site has an interesting property...instead of pressing enter one should press "ctrl+j" to enter commands etc. Any ideas to make this work in python? regards __________________________________________________ Do You Yahoo!? Tired of spam? Yahoo! Mail has the best spam protection around http://mail.yahoo.com

6 11

names
by Diana Furr Sept. 2, 2004

Sept. 2, 2004

How do you get Python to let name=(anyone's name) I saw some posts on this subject but didn't find an answer. Thank you, Diana

4 3

How can I catch a Windows event?
by goldperger＠st.nograd.net Sept. 2, 2004

Sept. 2, 2004

Hi, I am new in computing and python. My problem is during switching off/ restaring Win 98 the phyton script written by me doesnt stop. (in Win XP. no problem) I gues it is because of a thread. By checking from the internet I found the WM_QUERYENDSESSION should be caught for regular stopping, but I do not understand how. I am also not sure, which I should use win 32all or wxPython. The following script stops the win98 shutdown process if I start the script from consol. python 2.3.3 Win98SE #-------------------------------------------------------------------------- from threading import Thread from time import sleep stop_now=0 #It must changed into 1 when event WM_QUERYENDSESSION happens class Test_thread_app(Thread): def run(self): global stop_now n=0 while n<10 and (not stop_now): sleep(5) n=n+1 print str(n) if __name__=="__main__": myApp=Test_thread_app() myApp.start() myApp.join() #---------------------------------------------------------------------------- Is there any solution for catching this kind of event? Is there other solution advised? Andras Goldperger

2 1

Static Variables
by Ashkan Aliabadi Sept. 2, 2004

Sept. 2, 2004

Hi folks, Man, I never knew static could mean so much! That's the difference between a pro and a newbie, By static variable I meant a variable that holds it's value between function calls as in C, like Mr.Yoo's example or this one: /* I know this is not a good example but I guess it can show what I mean */ #include <stdio.h> void print_star(void); int main(void){ for (counter = 0; counter <50; ++counter){ print_star(); } return 0; } void print_star(void){ static int i = 0; if (i<50){ putchar('*'); ++i; } } By the way, would anyone guide me how to become a pro in C (an e-book, some maillists, some hints or just whatever you think may be helpful)? I read Kernighan and Ritchie's "THE C PROGRAMMING LANGUAGE", but I need something that makes me a real man!! enough for now ;) so many questions, so little time ( or as Duke Nukem says: so many babes so little time ) thank you for being kind Ashkan A.

3 2

python editor
by Meisam GanjeAli Sept. 2, 2004

Sept. 2, 2004

hello what is the best pythin editor, and how can i extend my ability for python programming for web? thanks for your help. bye.

2 1

Editing files through Python
by Bryan Sept. 1, 2004

Sept. 1, 2004

Hi, I am a beginner in Python, and this is my first time using this list so I hope my question is acceptable. Basically, my goal is to read data files that are already on my hard drive into Python, and then edit them, deleting unneccesary portions of data. I have already figured out how to read the files into Python, I just cannot figure out how to edit them. Here are the difficulties: How do I delete, cut, or paste portions of the data I am reading and how do I tell the program to jump to that specific portion of data that I want to alter? Here is a somewhat complicated example, similar to what I want to do - I have two rows of numbers, as shown below. Each row has 10 numbers (hopefully they will show up as two rows of numbers in the email (1-10 and 11-20). 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 What commands might I use to automatically go through each row, deleting the 6th through 10th numbers in each row (6-10 in the first row and 16-20 in the second row). I would like to write a program because I have hundreds of rows like this. I appreciate any help Thanks Bryan --------------------------------- Do you Yahoo!? New and Improved Yahoo! Mail - Send 10MB messages!

5 6

Drive listing
by Ole Jensen Sept. 1, 2004

Sept. 1, 2004

How is it possiple to list the drives on a current system? is there som module that will output this some thing like listdrives() ? I have browsed the Global Module Index for relating functions but haven't found anything. Or would I need to create my own function? something similiar to. Not testet: from os.path import exists from string import ascii_lowercase as lcase def drive(): for i in lcase: drive = i + ':/' drives = [] if exists(drive): drives.append(drive) return drives Ole Jensen

2 1

AIM client
by Asif Iqbal Aug. 31, 2004

Aug. 31, 2004

Hi All I am trying to send an IM to a buddy using putty as a reminder. In other words I write a at schedule which will trigger an IM to a buddy just as a reminder. Currently I am using simple email as a reminder. I am looking to use it in linux or Solaris Thanks for any suggestion/direction -- Asif Iqbal PGP Key: 0xE62693C5 KeyServer: pgp.mit.edu There's no place like 127.0.0.1

2 1

Re: [Tutor] need help with comparing list of sequences in Python!!
by Fathima Javeed Aug. 31, 2004

Aug. 31, 2004

Hi Kent To awnser your question: well here is how it works sequence one = aaabbbbcccc length = 11 seq 2 = aaaccccbcccccccccc length = 18 to get the pairwise similarity of this score the program compares the letters of the two sequences upto length = 11, the length of the shorter sequence. so a match gets a score of 1, therefore using + for match and x for mismatch aaabbbbcccc aaaccccbcccccccccc +++xxxxx+++ there fore the score = 6/11 = 0.5454 or 54% so you only score the first 11 letters of each score and its is not required to compare the rest of the sequence 2. this is what the distance matrix is doing match score == 6 The spaces are deleted to make both of them the same length >From: Kent Johnson <kent_johnson(a)skillsoft.com> >To: "Fathima Javeed" <fathimajaveed(a)hotmail.com>, tutor(a)python.org >Subject: Re: [Tutor] need help with comparing list of sequences in >Python!! >Date: Mon, 30 Aug 2004 13:53:19 -0400 > >Fuzzi, > >How do you count mismatches if the lengths of the sequences are different? >Do you start from the front of both sequences or do you look for a best >match? Do you count the extra characters in the longer string as mismatches >or do you ignore them? An example or two would help. > >For example if >s1=ABCD >s2=XABDDYY >how many characters do you count as different? > >Kent > >At 07:00 PM 8/29/2004 +0100, Fathima Javeed wrote: >>Hi, >>would really appreciate it if someone could help me in Python as i am new >>to the language. >> >>Well i have a list of protein sequences in a text file, e.g. (dummy data) >> >>MVEIGEKAPEIELVDTDLKKVKIPSDFKGKVVVLAFYPAAFTSVCTKEMCTFRDSMAKFNEVNAVVIGISVDP >>PFS >> >>MAPITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEELKSKG >> >>APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACL >>SVND >> >>HGFRFKLVSDEKGEIGMKYGVVRGEGSNLAAERVTFIIDREGNIRAILRNI >> >>etc etc >> >>They are not always of the same length, >> >>The first sequence is always the reference sequence which i am tring to >>investigate, basically to reach the objective, i need to compare each >>sequence with the first one, starting with the the comparison of the >>reference sequence by itself. >> >>The objective of the program, is to manupulate each sequence i.e. randomly >>change characters and calculate the distance (Distance: Number of letters >>between a pair of sequnces that dont match DIVIDED by the length of the >>shortest sequence) between the sequence in question against the reference >>sequence. So therefore need a program code where it takes the first >>sequence as a reference sequence (constant which is on top of the list), >>first it compares it with itself, then it compares with the second >>sequence, then with the third sequence etc etc each at a time, >> >>for the first comparison, you take a copy of the ref sequnce and >>manupulate the copied sequence) i.e. randomly changing the letters in the >>sequence, and calculating the distances between them. >>(the letters that are used for this are: A R N D C E Q G H I L K M F P S T >>W Y V) >> >>The reference sequence is never altered or manupulated, for the first >>comparison, its the copied version of the reference sequence thats >>altered. >> >>Randomization is done using different P values >>e.g for example (P = probability of change) >>if P = 0 no random change has been done >>if P = 1.0 all the letters in that particular sequence has been randomly >>changed, therefore p=1.0 equals to the length of the sequence >> >>So its calculating the distance each time between two sequences ( first is >>always the reference sequnce and another second sequence) at each P value >>( starting from 0, then 0.1, 0.2, ....... 1.0). >> >>Note: Number of sequnces to be compared could be any number and of any >>length >> >>I dont know how to compare each sequence with the first sequnce and how to >>do randomization of the characters in the sequnce therefore to calculate >>the distance for each pair of sequnce , if someone can give me any >>guidance, I would be greatful >> >>Cheers >>Fuzzi >> >>_________________________________________________________________ >>Stay in touch with absent friends - get MSN Messenger >>http://www.msn.co.uk/messenger >> >>_______________________________________________ >>Tutor maillist - Tutor(a)python.org >>http://mail.python.org/mailman/listinfo/tutor > _________________________________________________________________ It's fast, it's easy and it's free. Get MSN Messenger today! http://www.msn.co.uk/messenger

2 1